Cannabis derivat/ THC- Synthese

    • Akkarin187
      Akkarin187
      Global
      Dabei seit: 14.11.2008 Beiträge: 763


      Hallo,
      ich habe mal vor langer Zeit einen Vortrag über den Wirkstoff von Cannabis gehalten.
      Da mich allgemein die organische chemie sehr interresiert und ich schon einige stoffe ;wie der wirkstoff von Aspirin (Acetylsalicylsäure); synthetisiert habe, möchte ich mal gerne in naher Zukunft aus Interrese mal den Wirkstoff von Cannabis synthetisieren.
      Die zwei Hauptgründe dafür sind:

      - THC wird in der Medizin auch genutzt
      - meine Interesse an den Reaktionsmechanismen bei der Synthese


      Hierzu erst einmal eine allgemein Information zu THC

      Cannabis ist ein Naturprodukt, mit Tetrahydrocannabinol (delta9-THC) als dem psychoaktiven Hauptbestandteil. Die Cannabis-Pflanze (Cannabis sativa L.) ist weit verbreitet und wächst in Gegenden mit gemäßigtem und tropischem Klima. Zusammen mit Tabak, Alkohol und Koffein ist sie eine der am meisten konsumierten Drogen weltweit und wurde seit jeher als Droge und als Faserlieferant verwendet. Pflanzliches Cannabis besteht aus den getrockneten Blütenspitzen und Blättern. Cannabisharz ist eine Pressmasse aus den harzigen Teilen der Pflanze, und Cannabisöl (Haschischöl) ist ein Lösemittelextrakt von Cannabis. Cannabis wird fast ausschließlich geraucht, oft vermischt mit Tabak. Nahezu der gesamte Verbrauch von pflanzlichem Cannabis und von Harz beruht auf illegalem Material. Für Cannabis wurde ein gewisser therapeutischer Nutzen als Analgetikum geltend gemacht, und Dronabinol ist als Medikament in einigen Ländern zur Behandlung von Übelkeit bei der Krebs-Chemotherapie zugelassen. Cannabis-Produkte und delta9-THC stehen unter internationaler Kontrolle.

      Zur Chemie:

      Hauptwirkstoff aller Cannabis-Produkte ist delta9- Tetrahydrocannabinol (delta9-THC oder einfach THC), das auch unter seinem Internationalen Freinamen (INN) Dronabinol bekannt ist. Die ungesättigte Bindung im Cyclohexenring liegt im gängigeren Nummerierungssystem der Dibenzopyranringe zwischen C-9 und C-10. Zu THC gibt es vier Stereoisomere, von denen jedoch nur das (–)-trans-Isomer (CAS-1972-08-03) natürlich vorkommt. Der volle systematische Name dieses THC-Isomers lautet (−)-(6aR,10aR)-6,6,9-Trimethyl-3-pentyl-6a,7,8,10a-
      tetrahydro-6H-benzo[c]chromen-1-ol. In Cannabis finden sich auch, mitunter in größeren Mengen, zwei verwandte Substanzen: delta9-Tetrahydrocannabinol-2-onsäure und delta9-Tetrahydrocannabinol-4-onsäure (THCA). Beim Rauchen wandelt sich THCA teilweise in THC um. Das aktive Isomer delta8-THC, bei dem die ungesättigte Bindung im Cyclohexenring zwischen C-8 und C-9 liegt, kommt in viel kleineren Mengen vor.

      MOLEKULARSTRUKTUR:



      Reaktionsmechanismus bei der Synthese:



      Bevor ich weiter fortfahre:
      Ich weiss nicht ob das hier gestattet ist und erfrage mal hier die Meinung der Moderatoren ob es mir erlaubt aus wissenschaftlichen Gründen dieses Thema und die Synthese anzusprechen.
      Bitte um eine antwort der Moderation =)

      lg
  • 19 Antworten
    • justspoon
      justspoon
      Black
      Dabei seit: 19.04.2007 Beiträge: 25.767
      dann ist bayer endlich pro cannabis <3

      zumindest pro den synthetischen scheiss und die pflanze bleibt weiterhin verteufelt und verboten.
    • michimanni
      michimanni
      Bronze
      Dabei seit: 02.08.2006 Beiträge: 65.192
      Hallo Akkarin187,

      wir lassen den Thread bis auf Weiteres offen, i.e. aus wissenschaftlichen Gründen dieses Thema und die Synthese anzusprechen ist in Ordnung.
      Wir behalten den Thread dabei natürlich im Auge und uns gleichzeitig vor, ihn ggf. zu schließen, wenn er in eine Richtung abdriftet, die nicht mit unseren Grundprinzipien vereinbar ist.

      @ all: Um hier ein schnelles Ende für den Thread zu unterbinden, weise ich vorab darauf hin, dass wir hier weder Spam noch Flames haben möchten und wir uns auch nicht im BBV befinden.


      Euch allen ein schönes Weihnachtsfest und Gruß,
      michimanni
    • Minhstar
      Minhstar
      Global
      Dabei seit: 07.08.2006 Beiträge: 7.161
      ok michmanni hast recht =) sry 4 my spam.

      hier mal ansätze zu der synthese, da mich organische chemie auch sehr interressiert =) .

      deine verfahrensmöglichkeiten sind :

      1.

      reaktion von olivetol mit diethylacetoglutarat:
      dieses verfahren wurde erstmalig von fahrenholtz, lurie und kienstead beschrieben.
      es zeichnet sich dadurch aus, dass beide isomere - delta1- und delta6-THC gebildet werden. die beiden isomere können nach der Reaktion mittels chromatographie getrennt werden. nachteilig bei dieser synthese ist, dass die endgültige ausbeute an THC nur sehr gering ist, jedoch ist die stereokonfiguration bei dieser reaktion richtig.

      2.

      kondensation von olivetol mit (+)-cis oder (+)-trans-p-menthadien-(2,8)-ol-1 mittels starker säuren:
      reaktionsmechanismus der delta6-THC-synthese aus (+)-trans-p-menthadien-(2,8)-ol-(1) und olivetol mittels starker säuren (säurekatalysierte kondensationsreaktion).
      diese methode ergibt eine 50%-ige ausbeute fuer delta6-THC und eine 90%-ige für das 1",1"-dimethylpentyl-derivat von THC:

      4.74g olivetol (oder die gleichmolare menge eines analogs), 4,03g (+)-cis oder trans-p-menthadien(2,8)-ol-1 (die razematische verbindung kann auch genutzt werden, aber die Ausbeute beträgt dann nur die hälfte) und 0,8g p-toluolsulfonsäure werden in 250ml benzol gegeben.
      es wird 2h (oder man verwendet 0,004M trifluoressigsäure anstelle der p-toluolsulfonsäure und kocht 5h am rückfluss.) lang am rückfluss gekocht.
      es wird abgekühlt, ether hinzugefuegt, mit NaHCO3 gewaschen und dann wird getrocknet und unter vakuum verdampft, um rund 9g einer mischung (diese kann auf 350g silicagel mit benzol chromatographiert werden.
      es löst das THC. die anschliessende verwendung von benzol und ether im Verhältnis 98:2 lösen ein unwirksames produkt. dann wird benzol und ether im verhältnis 1:1 verwendet. dies löst das unverbrauchte olivetol. es wird unter vakuum verdampft, um das olivetol zurückzugewinnen.)

      3.

      kondensation von olivetol mit p-menthadienol oder p-menthatrien(1,5,8) in flüssigem schwefeldioxid:
      löse 0,36g olivetol oder ein analog und 0,27g (+/-)-p-menthatrien(1,5,8) in 7ml fluessigem SO2. das ganze wird in einem schmelzrohr eingeschmolzen und 24h lang bei raumtemperatur stehen gelassen. das lösungsmittel wird anschliessend unter feuchtigkeitsausschluss verdampft. der ölige rückstand wird in ether aufgenommen und in der üblichen weise weiter gereinigt.

      4.

      kondensation von (+)-trans oder (+)-cis-p-menthadien-(2,8)-ol-(1) und olivetol in flüssigem schwefeldioxid: 0,427g olivetol wurden mit 0,356g (+)-trans-p-menthadien-(2,8)-ol-(1) in 8ml flüssigem SO2 eingeschmolzen und 70h bei raumtemperatur stehengelassen. bei diesem verfahren entstanden 742ml rückstand. dieser wurde in ether gelöst und in der üblichen art und weise gereinigt. Der rückstand wurde mittels 25g silicagel chromatographiert (1.benzol; 2. benzol/ether 98:2, benzol/ether 1:1).

      5.

      reaktion von verbinol (aus (-)-alpha-pinen hergestellt) und olivetol mittels BF3-etherat:
      dieses syntheseverfahren wurde zuerst von mechoulam, braun und gaoni beschrieben. vorteil bei dieser reaktion ist, dass eine der startverbindungen für die reaktion, alpha-Pinen, käuflich erworben werden kann und somit nicht arbeits- und zeit- und kostenintensiv selbst bereitet werden muss. grundsätzlich funktioniert die reaktion nach folgenden reaktionsschema. zuerst wird das pinen zu einem allylalkohol (verbinol) oxidiert. anschliessend wird in einer zweiten reaktion dieses verbinol mit olivetol zusammenkondensiert, was eine menge von nebenprodukten und das gewünschte olivetyl-pinen ergibt. dieses muss mittels chromatographischer verfahren abgetrennt werden. das olivetyl-pinen kann ind das delta6-THC umgewandelt werden und auch bei bedarf weiter in das natürliche Delta1-THC isomerisiert werden. ein weiterer vorteil bei dieser methode ist, dass die stereospezifität und die absolute, optische konfiguration kontrolliert werden, aber wiederum beschränken die notwendigen chromatographischen trennungen die endprodukte auf eine kleine menge.

      6.

      für l(-)-delta1-THC und delta6-THC von 2-epoxycaren:
      1M (+)-trans-2-carenoxid (2-epoxycaren), 1M olivetol oder ein analog und 0,05M p-toluolsulfonsaeure werden in 10l benzol gegeben. es wird 2h lang am rückfluss gekocht. anschliessend wird im vakuum verdunstet, (das unverbrauchte olivetol kann auch wie oben beschrieben abgetrennt werden.) um 30% ausbeute an THC zu erhalten. 3-carenoxid ergibt 20% ausbeute für delta-1(6)THC.

      7.

      delta1(6)-THC aus CBD (Cannabidiol) mittels säuren:
      1g CBD (cannabidiol) und 60mg p-toluolsulfonsäure (oder 0,003M trifluoressigsäure) in 50ml benzol werden 1,5h lang am rückfluss erhitzt. es wird im vakuum verdampft, um rund 0,7g THC zu erhalten.


      edit by minstar
      keine ahnung ob du das an uni laboren machst oder privat, aber es entstehen dabei giftige nebenprodukte und manche reaktion müssen unter abzug gemacht werden mmn (kein plan mit welchen chromatographischen Methoden du es dann reinigen willst damit dies "rein" wird).
      zu beachten der Rückluss- oder Liebigkühler darf bei der kondensationraktionen nicht kontaminiert sein.
      Neben der Apparatur , das Vorhandensein der einzelnen chemischen Stoffe sollte die Herstellung von Säuren mit einer definierten molaren Masse dir geläufig sein um die richtigen Lösungen anzusetzen
    • TheDuke0o
      TheDuke0o
      Bronze
      Dabei seit: 26.09.2006 Beiträge: 41
      hey,

      Da mich allgemein die organische chemie sehr interresiert und ich schon einige stoffe ;wie der wirkstoff von Aspirin (Acetylsalicylsäure); synthetisiert habe


      hat du villeicht salicylsäure mit essigsäureanhydrid acetyliert? das hab ich auch schon mal ;)

      die thc totalsynthese könnte aber etwas aufwändiger werden. die synthese ist jetzt nicht sonderlich komplex für einen naturstoff, aber ich denke du wirst schon einige wochen bis monate daran haben. darf ich fragen aus welcher publikation du den ausschnitt kopiert hast? die beiden ausgangsstoffe sind schonmal beide käuflich. der wissenschafltliche nutzen ist natürlich auch nicht soo gross das ding einfach nachzukochen, wenn du also deinen prof. oder vorgesetzten, sofern du nicht dein eigenes labor besitzt, überzeugen musst, kannst du ja irgend ein noch unbekanntes derivat davon herzustellen das dann auch getestet werden kann (in bioassays mein ich :D ).

      die molekularstruktur oben ist übrigens lsd, das musst du noch ändern. wenn du dich für psychoaktive substanzen und organische chemie/reaktionsmechanismen interessierst, kann ich dir diesen youtube channel empfehlen:
      http://www.youtube.com/user/Fenderson5555/videos

      viel spass
    • Akkarin187
      Akkarin187
      Global
      Dabei seit: 14.11.2008 Beiträge: 763
      Hallo,

      @Michimanni: Danke, es geht mir mehr um die chemimischen Reaktionsmechasnismen und Aufwand bei der Synthese.


      @Minhstar: Danke für die Vorschläge , ich habe mich auch schon etwas damit im Internet schlau gemacht.


      @Duke: ja danke das mit der Strukturformel ist gefixt.

      Ich hatte Acetylsalicylsäure schon mal vor langer Zeit bei einem organischen Chemie Modul synthethisiert.
      Ob ich es mit Essigsäureanhydrid acetyliert habe weiss ich im Stehgreif nicht mehr, aber bei Interesse kann ich mal in mein Protokol nochmal nachsehen.
      Ich werde mir mal Gedanken zur Apparatur machen und euch mal davon berichten welches Verfahren ich anwenden möchte.
    • Minhstar
      Minhstar
      Global
      Dabei seit: 07.08.2006 Beiträge: 7.161
      Jo, naja syntheseverfahren dürfte ja im internet leicht zu finden sein.
      du kannst ja dazu nach einigen naturwissenschaftlichen publikationen suchen.
      falls du in uni zu so ner chemie-arbeitgrupppe angehörst hast du auch ein vollen zugang für alle publikationen dort.

      http://www.ncbi.nlm.nih.gov/pccompound

      der rest sollte für einen etwas bewanderten person in OC mit den entsprechenden laborapparaten und den benötigten chemikalien locker machbar sein.

      viel spass

      edit by Minhstar
      wenn du es aus interesse machst oder wissen willst welche reaktionsmechanismen bei synthese abläuft ist es ok.
      aber auf jeden fall würde ich dir von testen/konsum abraten.
      meist sind die endprukte nicht so gut gereinigt das man es konsumieren kann und evtl. nebenprodukte noch stark enthalten sind.
      weder bei deiner acetylsalcylsäure noch bei deinem jetztzigen vorhaben ist es konsumfertig ;)
      in firmen ala bayer werden immer weitere aufwendige reinigungsschritte noch durchgeführt und daher sind diese dort produzierten stoffe meist immer reiner als die von euch selbst hergestellten sachen.
    • dvrvm
      dvrvm
      Bronze
      Dabei seit: 31.01.2007 Beiträge: 3.956
      Ich finde das ja spannend, aber es stellt sich die Frage nach der wissenschaftlichen Motivation.

      Naturstoffsynthese betreibt man im Wesentlichen aus 3 Gründen.
      1) um zu zeigen, dass es möglich ist, das von Menschenhand zu machen. (Beispiel etwa Maitotoxin und sowieso alles von KC Nicolaou.)
      2) um eine elegante Synthesestrategie zu demonstrieren, die mit wenigen und möglichst einfachen Schritten ein komplexes Molekül synthetisieren kann. (Musterbeispiel sind all die Mannich-Synthesen.)
      3) um einen schwierig oder nur in Kleinmengen zu isolierenden Naturstoff zugänglich zu machen.

      Dann kommt vielleicht noch 4) um einen modularen Syntheseweg aufzuzeigen, der durch die Verwendung von leicht anderen Edukten zu Analogen des Produkts führt. Damit könnte man dann SAR- oder andere Effektstudien machen.

      Für THC wurde 1) natürlich schon lange gezeigt, und eine reine Nachsynthese einer bekannten Synthesevorschrift hat auch insofern keinen wissenschaftlichen Wert, dass man damit nur zeigt, dass man kochen kann. 2) ist auch schon ziemlich ausgereizt, wie Minhstar aufzählt. Es gäbe sicher alternative Synthesen, die man sich überlegen könnte, aber sie werden vermutlich nicht mehr eleganter als diejenigen, die es bereits gibt... 3) ist für THC obv nicht der Fall, die Isolierung aus Pflanzenmaterial wäre ja beispiellos einfach :)

      Somit stellt sich einfach die Frage, wozu der ganze Aufwand. Wenn du ein Uni-Labor zur Verfügung hast, wirst du deine Zeit dort vermutlich sowieso mit etwas wissenschaftlich Wertvollerem verbringen müssen oder dürfen. Wenn du das zuhause machen willst, wovon ich schwer abrate, sehe ich nicht, was du davon hast ausser viel Aufwand. Während man sich das reine Syntheseequipment für einen guten Batzen Geld zusammenkaufen könnte, wäre jedes Gerät für instrumentelle Analytik far out of reach, und ergo hättest du jeweils nur eine grobe Ahnung, was du eigentlich gerade synthetisiert hast...

      Aber wenn wir schon dabei sind, was sind denn deiner Meinung nach die Überlegungen hinter der Retrosynthese, bzw. verstehst du, was die einzelnen Reaktionen bezwecken sollen?
    • skyblue
      skyblue
      Bronze
      Dabei seit: 29.01.2008 Beiträge: 930
      Er will doch einfach nur Drogen :D ?
    • dvrvm
      dvrvm
      Bronze
      Dabei seit: 31.01.2007 Beiträge: 3.956
      Naja, wenn jemand "einfach nur Drogen" will, gibt es ja in diesem Fall einen bekannten, relativ simplen Weg, um sie herzustellen. Das ist ja genau das, was ich schon sage. Dagegen kostet z.B. das Olivetol, einer der Ausgangsstoffe der Synthese, 50-100$/Gramm.

      Wenn ich ein Glas Wasser will, gehe ich auch zum Wasserhahn und isoliere nicht H2O als Nebenprodukt einer Kondensationsreaktion...

      Also wozu THC synthetisch herstellen? Die Synthese ist natürlich die Methode der Wahl, um etwa alle Arten von Amphetaminderivaten, oder auch die ganzen synthetischen Cannabinoide herzustellen. Aber niemand käme auf die Idee, Morphium (und Derivate) oder Kokain vollsynthetisch zu produzieren, weil sie einfach viel leichter aus der Natur zugänglich sind. (Die Synthesen wurden natürlich trotzdem schon aus wissenschaftlichem Interesse gemacht; aber für Zwecke der Produktion sind sie uninteressant.)

      Edit: Dazu kommt, dass wie gesagt ohne brauchbare Syntheseanalytik (NMR) gar nicht daran zu denken ist, irgendwelche Random-Reaktionen zu machen und das Produkt zu "verwenden"... Und so ein kleines Küchen-NMR-Spektrometer hat nun wirklich nicht unbedingt jeder zu Hause.
    • Akkarin187
      Akkarin187
      Global
      Dabei seit: 14.11.2008 Beiträge: 763
      Hallo,
      ich hatte bisher keine Zeit mich weiter damit zu beschäftigen und über Weihnachtstage wird sich auch nichts ändern.
      Aber um es vorab zu klären, damit hier kein Missverständniss aufkommt.
      Natürlich will ich aus Neugier den Wirkstoff (für manche hier die Droge) mal versuchen zu synthetisieren.
      Bewegründe sind wie schon aufgefüfhrt weil THC zusammen mit Tabak, Alkohol und Koffein eine der am meisten konsumierten Drogen weltweit ist.
      THC auch chemisch gesehen z.B. im Vergleich zu alkohol nicht körperlich süchtig machen kann und es eigentlich sogar harmloser ist als manch andere leichte Drogen,die ihr täglich konsumiert ( aber das ist wieder ein anderesThema ;) ).
      Der Hauptgrund ist halt Interesse an dem Verfahren um mal zu wissen wie Zeit- und Kostenintensiv die Synthese ist und welche chemischen Reaktionen dabei stattfinden.
      Mir ist klar (und anderen sollte es spätestens jetz auch klar sein), dass die Synthese von Zeit und kostengründen her äusserst unproduktiv ist, und wer halt sowas konsumieren möchte ist mit einem Besuch im Nachbarland und dem Homegrow wesentlich besser bedient.
      Aber darum geht es mir ja hier auch nicht.
      @dvrm: zu deinen Fragen warum ich sowas mache:
      Ich möchte jetzt bestimmt keine neue und eleganteren Verfahrensmöglichkeiten entwickeln und etablieren. Wie du schon gesagt hast sind diese Verfahren zur THC Synthese schon ziemlich ausgereizt.
      Natürlich ist es kein grosser Akt fertige Verfahren nachzukochen, aber mir geht es halt darum aus Interesse einmal (also jetzt bestimmt keine Massenproduktion geplant ) sowas evtl zu probieren.
      Vieleicht kann man es vergleichen mit dem zusammenbauen eines Fahrrads.
      Es hat für einen halt selber einen viel höheren Stellenwert wenn man sich ein Fahrrad aus kleinen Einzelteilen zusammenbaut als wenn man jetzt ein komplett fertiges Fahrrad kauft.

      So nun mal kurz zur synthese.
      Ich wollte zuerst die Synthese THC mittels einer Substituionsreaktion von zwei aromatischen Stoffen (olivetol und diethylacetoglutarat) unter Abspaltung von Wasser und dem anschliessend Anheften der Methylgruppe (CH3) durchführen.
      Apparatur und Durchführung ist eigentlich kein Problem aber anscheinend die Chemikalien.
      Aber ich hab mich mal informiert.
      Du hattest recht dvrm ;) , 1g Olivetol kostet 76$ !!!

      http://www.scbio.de/datasheet-236251-olivetol.html

      Wenn ich das nicht bei uns irgendwoher besorgen kann im Lager werd ich bestimmt aus Neugier jetzt nicht mehrere Hundert Dollar für den Versuch selber investieren, zumal dies eigentlich nur aus Interesse ist.
      Ansosnten muss ich mal erkundigen nach einem kostengünstigeren Syntheseweg.
      Naja und das mit der NMR-Spektroskopie zu Analytik stimmt zwar, aber wir wollen die kirche mal im dorf lassen und es mal nicht übertrieben, da dies in erster Linie als Hobby oder Neugierbefriedigung angesehen werden soll ;)

      allen noch besinnliche Feiertage

      edit:
      irgendwie laufen alle Synthesesreaktion die ich mir bisher angesehen hab mit Olivetol als Ausgangsprodukt ab ?
      auch die Substitutionsreakton mit Verbinol / Pinen :rolleyes: wtf

    • Minhstar
      Minhstar
      Global
      Dabei seit: 07.08.2006 Beiträge: 7.161
      lol eigentlich wollte ich mich aus der community zurückziehen aber für the voice of germany und wissenschaftliche themen mach ich gerne ne ausnahme. =)
      da auf chemischem synthesewege die thc produktion nicht rentabel ist solltest du bei interrese mal überlegen die thc produktion auf molekularbiologischen wege anzustreben.
      wenn du laborerfahrung hast und evtl zugang zu laboren hast dann ist eigentlich die thc produktion auf diesem wege in massen rentabel.
      mein ansatz hierbei ist die THc produktion in prokayronten ( vlt e. coli bakterien ) durch fermentation zu veranlassen.

      hierzu mal eine grober versuchsansatz (íst bestimmt in detail noch ausbaufähig aber das grobe müsste soweit stimmen):
      (die anleitung dürfte für einen der damit erfahrung hat leicht verständlich sein)

      1.
      du suchst dir in der NCBI Datenbank in dem Zielorganismus Cannabis sativa mal die kodierende Sequenz für das thc gen aus.
      auf jeden fall dich vergewissern das dies auch die richtige Sequenz ist.
      Diese Sequenz brauchst du halt um das 5` ende und das 3` ende des THC gens zu bestimmen.
      Sollte das 5` ende und das 3` ende des THC gens in der datenbank nicht enthalten (was ich aber nicht glaube), muss du dies experimentiell mit nem verfahren des 5´RACE / 3´RACE selber herausfinden.

      http://www.ncbi.nlm.nih.gov/

      2.
      du isolierst die DNA aus aus c.sativa (gibt zig verfahren und einfachhalber fertig-kits von invtrogen/quiagen etc käuflich zu erwerben).
      aus der DNA noch die (gesplicte DNA) cDNA synthese durchführen da du ja keine intron-sequenzen des thc gens haben willst.

      3.
      du generierst forward und reverse primer (oligonukliotide) mit nach bedarf entspechenden restriktionsschnittstellen für das thc gen für die amschliessend PCR.
      da du die sequenz aus der ncbi datenbank kennst ist dies ja kein problem.

      4.
      amplifikation des THC gens mittles PCR mit deinen generierten Primern und der cDNA aus C. sativa als template.

      5.
      PCR produkt auf agarosegel laufen lassen.
      aufreinigung (eluatiuon) der PCR produktes und dann anschliessend die klonierung in einem expressionsvektor.
      wenn du e. coli bakterien zur expression nimmst kannst du ja gängige fertig-vektoren für deine klonierung benutzen.
      z.B. der pGemt- Vektor (promega), diese plamid (liefert starke expression in e. coli) ist eigentlich schon ready to use aber muss evtl mit restriktionsenzymen vorverdaut werden wenn du an deine primer restriktionsschnittstellen angefügt hast.



      6.
      wenn die klonierung erfolgreich war dann das plasmid mittels elektroporation oder lipid transformation in die e. coli bakterien einbringen.

      7.
      nun den bakterien auf agarboden und in brutschrank sich paar tage vermehren lassen und anschliessend eine zellkultur animpfen damit du eine ausreichende menge hast.

      8.
      isolation des thc produktes aus den e.coli zellen.
      hier gibt es auch zahlreiche erwerbliche fertig kits von invitrogen etc / oder aus kostengründen machst du es selber.

      mal so ne versuchs-idee von mir, aber müsste soweit stimmen und machbar sein.
      ein paar kontrollversuche usw hab ich mal der einfachheitshalber hier ausgelassen und die kosten der materialien (fertig kits/plasmide/ enzyme usw.) sind nun nicht unerheblich, aber wenn man es schon parat hat ist dies ja ok und dies sollte nur eine idee sein, natürlich im sinne der wissenschaft =)

      edit by Minhstar
      mit hilfe der methode lassen sich auch transgene pflanzen herstellen mittels viraler rekombination.
      D. h. es müsste dann möglich sein dass du damit deine normale zimmerpflanze so veränderst, dass sie THC produzieren. :f_cool:
      (ist aber illegal wegen den dazu benögtigten viren)
    • Pokerfu
      Pokerfu
      Global
      Dabei seit: 11.02.2008 Beiträge: 7.523
      Original von Minhstar
      D. h. es müsste dann möglich sein dass du damit deine normale zimmerpflanze so veränderst, dass sie THC produzieren. :f_cool:
      (ist aber illegal wegen den dazu benögtigten viren)[/I]
      :f_love: hehe nice
    • IgNoRaNt
      IgNoRaNt
      Bronze
      Dabei seit: 18.03.2006 Beiträge: 2.303
      Nur mal so am Rande. Stehen Dir überhaupt Möglichkeiten zur Analytik und das dazu nötige Wissen zur Verfügung? Ist ja eher witzlos nacher eine irgendwie geartetet Masse zu haben und einfach zu behaupten es sei die Zielsubstanz.

      Hast Du auch irgendwelche komplexen organischen Synthesen durchgeführt? Aspirinsynthese ist ja eher was für den Chemieunterricht in der Schule.
    • dvrvm
      dvrvm
      Bronze
      Dabei seit: 31.01.2007 Beiträge: 3.956

      irgendwie laufen alle Synthesesreaktion die ich mir bisher angesehen hab mit Olivetol als Ausgangsprodukt ab?
      Bin gerade am Smartphone, darum schreibe ich nichts Ausführlicheres dazu, aber: Was denkst du, ist der Gtund, warum die gängigen Synthesen von Olivetol ausgehen, und was wären Alternativen, wenn man kein Olivetol verwenden will?

      Minhstar, die Idee ist zwar nicht schlecht, man müste aber dann wohl den ganzen biosynthetischen Komplex mitklonieren. Muss mal recherchieren, ob das schon mal gemacht wurde. Wenn man nur ein Enzym kloniert, katalysiert es ja nur einen Schritt in der Biosynthese, und dann müsse man die Colis mit dem direkten Vorläufer füttern...
    • Minhstar
      Minhstar
      Global
      Dabei seit: 07.08.2006 Beiträge: 7.161
      Original von dvrvm
      Minhstar, die Idee ist zwar nicht schlecht, man müste aber dann wohl den ganzen biosynthetischen Komplex mitklonieren. Muss mal recherchieren, ob das schon mal gemacht wurde. Wenn man nur ein Enzym kloniert, katalysiert es ja nur einen Schritt in der Biosynthese, und dann müsse man die Colis mit dem direkten Vorläufer füttern...
      ich hab mich nicht informiert ob es eine gen oder mehrere sind, die in c.sativa für die thc bildung zuständig sind.
      aber wenn es auch mehere sind ( so bist max 5 schätze ich mal höchstens) ist es ja auch keíne problem dann so ein expressionsystem zu erstellen.
      du klonierst downstream des sp6/t7- promotors (auf jeden fall ein sehr starker promotor in e. coli zellen)die isolierten gene das c. sativa rein und musst halt nur auf den richtigen open reading frame achten und das es kein frame shift gibt und baust mit oligonukleotiden gegebenfalls noch eine multiple cloning site (MCS) für die klonierungstrategie mehrerer gene hintereinander in den vektor ein.
      ob der promotor nun ein gen transkribiert oder mehrere hintereinander ist jetzt nicht das problem (hauptsache er liefer eine starke transkription in den zielorganismus, was ja hier der fall ist).
      so ein vektor-system zusammenzubauen ist wie lego spielen und da kannste nach belieben die komponenten im vektor einfügen oder rausnehmen.
      musst nur dich vergewissern das das exprimierte produkt jetzt nicht toxisch für den e.coli organismus ist, andernfalls musst du dir einen anderen organismus zur thc expression aussuchen.

      edit:
      ich hab es dir mal aufgemalt wie ich mir den vektor und die klonierungsstrategie so vorstelle, damit man es evtl besser nachvollziehen kann und das plasmid mal liebevoll P/THC-Minstar genannt ;)



      Abb. :klonierungsstrategie für thc gen.
      thc gene können über der multiple kloning site (MCS) in das plasmid hineinkloniert werden.
      in diesem fall über die restriktionsschnittstellen HindIII und EcorI / bzw EcorI und XbaI.
      V5 epitop und his tag dienen nur zur markierung und aufreinung des plasmid und spielen hierbei keine rolle.
      der polya schwanz des simian virus ist für die hohe langlebigkeit der mRNA in e. coli zuständig




      Wenn du dies in e.coli bakterien einschleust ( mittels transformation), so sollten die genmanipulierten bakterien dann in der lage sein durch fermentation THC zu produzieren.

      edit2: (hier die kodierende Sequenz des Gens für die Klonierung, einer davon zumindest, ich hab in der schnelle jetzt keine weiteren gefunden)
      Cannabis sativa mRNA for tetrahydrocannabinolic acid synthase precursor, complete cds

      GenBank: AB057805.1
      LOCUS AB057805 1885 bp mRNA linear PLN 15-SEP-2004
      DEFINITION Cannabis sativa mRNA for tetrahydrocannabinolic acid synthase
      precursor, complete cds.
      ACCESSION AB057805
      VERSION AB057805.1 GI:26005813
      KEYWORDS .
      SOURCE Cannabis sativa (hemp)
      ORGANISM Cannabis sativa
      Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
      Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons;
      rosids; fabids; Rosales; Cannabaceae; Cannabis.
      REFERENCE 1
      AUTHORS Sirikantaramas,S., Morimoto,S., Shoyama,Y., Ishikawa,Y., Wada,Y.,
      Shoyama,Y. and Taura,F.
      TITLE The gene controlling marijuana psychoactivity: molecular cloning
      and heterologous expression of Delta1-tetrahydrocannabinolic acid
      synthase from Cannabis sativa L
      JOURNAL J. Biol. Chem. 279 (38), 39767-39774 (2004)
      PUBMED 15190053
      REFERENCE 2 (bases 1 to 1885)
      AUTHORS Taura,F., Shoyama,Y. and Morimoto,S.
      TITLE Direct Submission
      JOURNAL Submitted (21-MAR-2001) Futoshi Taura, Kyushu University, Graduate
      School of Pharmaceutical Sciences; Maidashi 3-1-1, Fukuoka
      812-8582, Japan (E-mail:tauraf@shoyaku.phar.kyushu-u.ac.jp,
      Tel:81-92-642-6582, Fax:81-92-642-6582)
      FEATURES Location/Qualifiers
      source 1..1885
      /organism="Cannabis sativa"
      /mol_type="mRNA"
      /db_xref="taxon:3483"
      CDS 27..1664
      /codon_start=1
      /product="tetrahydrocannabinolic acid synthase precursor"
      /protein_id="BAC41356.1"
      /db_xref="GI:26005814"
      /translation="MNCSAFSFWFVCKIIFFFLSFHIQISIANPRENFLKCFSKHIPN
      NVANPKLVYTQHDQLYMSILNSTIQNLRFISDTTPKPLVIVTPSNNSHIQATILCSKK
      VGLQIRTRSGGHDAEGMSYISQVPFVVVDLRNMHSIKIDVHSQTAWVEAGATLGEVYY
      WINEKNENLSFPGGYCPTVGVGGHFSGGGYGALMRNYGLAADNIIDAHLVNVDGKVLD
      RKSMGEDLFWAIRGGGGENFGIIAAWKIKLVAVPSKSTIFSVKKNMEIHGLVKLFNKW
      QNIAYKYDKDLVLMTHFITKNITDNHGKNKTTVHGYFSSIFHGGVDSLVDLMNKSFPE
      LGIKKTDCKEFSWIDTTIFYSGVVNFNTANFKKEILLDRSAGKKTAFSIKLDYVKKPI
      PETAMVKILEKLYEEDVGAGMYVLYPYGGIMEEISESAIPFPHRAGIMYELWYTASWE
      KQEDNEKHINWVRSVYNFTTPYVSQNPRLAYLNYRDLDLGKTNHASPNNYTQARIWGE
      KYFGKNFNRLVKVKTKVDPNNFFRNEQSIPPLPPHHH"
      ORIGIN
      1 aaaaaaatca ttaggactga agaaaaatga attgctcagc attttccttt tggtttgttt
      61 gcaaaataat atttttcttt ctctcattcc atatccaaat ttcaatagct aatcctcgag
      121 aaaacttcct taaatgcttc tcaaaacata ttcccaacaa tgtagcaaat ccaaaactcg
      181 tatacactca acacgaccaa ttgtatatgt ctatcctgaa ttcgacaata caaaatctta
      241 gattcatctc tgatacaacc ccaaaaccac tcgttattgt cactccttca aataactccc
      301 atatccaagc aactatttta tgctctaaga aagttggctt gcagattcga actcgaagcg
      361 gtggccatga tgctgagggt atgtcctaca tatctcaagt cccatttgtt gtagtagact
      421 tgagaaacat gcattcgatc aaaatagatg ttcatagcca aactgcgtgg gttgaagccg
      481 gagctaccct tggagaagtt tattattgga tcaatgagaa gaatgagaat cttagttttc
      541 ctggtgggta ttgccctact gttggcgtag gtggacactt tagtggagga ggctatggag
      601 cattgatgcg aaattatggc cttgcggctg ataatattat tgatgcacac ttagtcaatg
      661 ttgatggaaa agttctagat cgaaaatcca tgggagaaga tctgttttgg gctatacgtg
      721 gtggtggagg agaaaacttt ggaatcattg cagcatggaa aatcaaactg gttgctgtcc
      781 catcaaagtc tactatattc agtgttaaaa agaacatgga gatacatggg cttgtcaagt
      841 tatttaacaa atggcaaaat attgcttaca agtatgacaa agatttagta ctcatgactc
      901 acttcataac aaagaatatt acagataatc atgggaagaa taagactaca gtacatggtt
      961 acttctcttc aatttttcat ggtggagtgg atagtctagt cgacttgatg aacaagagct
      1021 ttcctgagtt gggtattaaa aaaactgatt gcaaagaatt tagctggatt gatacaacca
      1081 tcttctacag tggtgttgta aattttaaca ctgctaattt taaaaaggaa attttgcttg
      1141 atagatcagc tgggaagaag acggctttct caattaagtt agactatgtt aagaaaccaa
      1201 ttccagaaac tgcaatggtc aaaattttgg aaaaattata tgaagaagat gtaggagctg
      1261 ggatgtatgt gttgtaccct tacggtggta taatggagga gatttcagaa tcagcaattc
      1321 cattccctca tcgagctgga ataatgtatg aactttggta cactgcttcc tgggagaagc
      1381 aagaagataa tgaaaagcat ataaactggg ttcgaagtgt ttataatttt acgactcctt
      1441 atgtgtccca aaatccaaga ttggcgtatc tcaattatag ggaccttgat ttaggaaaaa
      1501 ctaatcatgc gagtcctaat aattacacac aagcacgtat ttggggtgaa aagtattttg
      1561 gtaaaaattt taacaggtta gttaaggtga aaactaaagt tgatcccaat aattttttta
      1621 gaaacgaaca aagtatccca cctcttccac cgcatcatca ttaattatct ttaaatagat
      1681 atatttccct tatcaattag ttaatcatta taccatacat acatttattg tatatagttt
      1741 atctactcat attatgtatg ctcccaagta tgaaaatcta cattagaact gtgtagacaa
      1801 tcataagata tatttaataa aataaattgt ctttcttatt tcaatagcaa ataaaataat
      1861 attattttaa aaaaaaaaaa aaaaa
    • dvrvm
      dvrvm
      Bronze
      Dabei seit: 31.01.2007 Beiträge: 3.956
      Naja, wenn man das THC-Molekül anschaut, fällt ja auf, dass der rechte Teil (der Olivetol-Teil) ein Polyketid ist. Die Polyketid-Synthase, die diesen Teil des Moleküls synthetisieren kann, wird schon einmal ein Gen sein. Ebenfalls fällt auf, dass der linke Teil ein Terpenskelett hat, den Terpenvorläufer GPP sollte E.coli vermutlich schon selber herstellen können, wenn auch die Mengen evtl. klein sind... Dann ein Enzym, welches die Kondensation macht, und weitere 1-2, die "Rumgebastel" am Ende noch machen.

      PlantCyc sagt dazu:

      http://biocyc.org/META/NEW-IMAGE?type=PATHWAY&object=PWY-5140



      THC wird also in C. sativa sogar aus Olivetol-Säure (statt aus Olivetol) hergestellt und im allerletzten Schritt decarboxyliert. Man muss also

      * eine Olivetolsäure-Synthase (die ist leider nicht ausdrücklich bekannt, so wie es aussieht)
      * die CBGA-Synthase, die Olivetolsäure + GPP kondensiert
      * die THCA-Synthase, die du gefunden hast und den Ringschluss macht

      einbauen. THCA -> THC geht dann von selber. Ob GPP und die Olivetol-Vorläufer dann in genügenden Mengen vorhanden sind, ist die andere Frage. Eventuell sollte man noch eine GPP-Synthase dazupacken und die Bakterien irgendwie so füttern, dass die Vorläuferproduktion maximiert wird.


      Zur Olivetolsäure-Synthase: Dieses Paper beschreibt eine Olivetol- (nicht Olivetolsäure)-Synthase aus C. sativa. Es wäre aber aus meiner Sicht sehr seltsam, wenn Olivetol dann zu Olivetolsäure umgewandelt würde; jedenfalls nicht unbedingt das, was man sonst so in Biosynthese-Pathways sieht.

      In Dortmund sind sie übrigens genau an diesem Thema dran. So wie ich das lese, starten sie aber derzeit direkt von Olivetol aus (also, sie füttern die Bakterien/Hefen mit Olivetol):
      http://www.tb.bci.tu-dortmund.de/index.php?option=com_content&view=article&id=40&Itemid=49
    • dvrvm
      dvrvm
      Bronze
      Dabei seit: 31.01.2007 Beiträge: 3.956
      Weil mir langweilig ist, habe ich noch rasch die Biosynthese von THCA gezeichnet, wo man den Polyketid- und den Terpenoid-Baustein sieht. Die => Pfeile sind "Retrosynthese-Pfeile" und bedeuten "kommt von" bzw. "wird hergestellt aus". Der Teil rechts unten ist Spekulation. "OPP" ist Kurzschreibweise für "O-PO2-PO3 3-".



      Btw scheint die Doppelbindung in OPs Bild falsch zu liegen, das wäre dann delta-8-THC... Macht insofern auch Sinn, da delta-9 dann die "natürliche" Position der Doppelbindung des Terpenvorläufers ist.
    • SlowLarry
      SlowLarry
      Bronze
      Dabei seit: 07.04.2006 Beiträge: 940
      Was genau muss man studieren, um hier mitreden zu können? Ist ja schon beeindruckend, was alles möglich ist.
    • Akkarin187
      Akkarin187
      Global
      Dabei seit: 14.11.2008 Beiträge: 763
      Original von SlowLarry
      Was genau muss man studieren, um hier mitreden zu können? Ist ja schon beeindruckend, was alles möglich ist.
      Hi,
      Dies geht in die Richtung organische Chemie/ molekulare Genetik/Gentechnologie/Biophysik/Biochemie


      Hallo,
      Vorerst mal ein großes Dankeschön an Minhstar und dvrvm für die Beiträge:s_thumbsup:
      Ihr hattet recht :s_cool: ,
      ich habe mich mal erkundigt welche Wege es gibt die THC Synthese vor allem kostengünstig herzustellen.
      Bisher war die chemische Synthese von THC wirtschaftlich nicht rentabel, da vermutlich das Ausgangsprudukt Olivetol (wie dvrm schon sagte 1g: 50-100 Euro!) nicht gerade preisgünstig ist.
      Durch eure Post und die Idee die Synthese dann auf biochemichen Wege anzugehen habe ich mich mal informiert.
      Es ist neuerdings einer biochemischen Forschungsgruppe von Prof. Oliver Kayser an der TU Dortmund gelungen den Cannabis-Wirkstoff mit Hilfe von genmanipulierten E.coli Bakterien zu produzieren.
      Weltweit war dies bist dato noch nicht möglich gewesen die THC Produktion in Mikroorganismen einzuleiten und diese Innovation bietet nun Wege THC kostengünstig zu synthetisieren (einfach der Hammer! :heart: ).

      http://www.tb.bci.tu-dortmund.de/

      diese Wissenschafter aus Dortmund haben Bakterien per Gen-Manipulation dazu gebracht, den Hauptwirkstoff von Cannabispflanzen zu produzieren.
      Das Verfahren sei im Vergleich zu den bisher in Deutschland zulässigen Herstellungsverfahren vergleichsweise unaufwendig und damit günstiger.

      Bisher aufwendige Herstellung

      THC werde in Deutschland bisher aus Faserhanf gewonnen, dessen Anbau oder Einfuhr legal ist. "Da die Fasern weniger als 0,2 Prozent THC enthalten, ist der Produktionsprozess entsprechend aufwendig".
      Aus der Cannabispflanze, die bis zu 25 Prozent THC enthalten kann, darf der Wirkstoff aus juristischen Gründen in Deutschland nicht gewonnen werden. Als Ausweg bleibe nur die Herstellung von synthetischem THC. Dies sei jedoch "extrem aufwendig und teuer".
      Insgesamt könn(ten in Deutschland so nur 20 Kilogramm pro Jahr produziert werden. "Der tatsächliche Bedarf liegt aber bei über einer Tonne", schätzt Kayser.
      Koste das Kilo bisher rund 50.000 Euro, rechnet Kayser mit Kosten von künftig rund 2.500 Euro je Kilogramm THC.


      THC Synthese per Fermentation

      Bei dem von dem Dortmunder Biochemiker in den vergangenen fünf Jahren entwickelten Verfahren kommen Koli-Bakterien (Escherichia coli) zum Einsatz. Ihnen werden die isolierten Gene, die in der Cannabispflanze für die THC-Bildung zuständig sind, eingepflanzt. Entsprechend vermehrt können die Bakterien dann durch Fermentation THC produzieren.
      Zusammen mit einem Pharmaunternehmen plant die Uni Dortmund nun die Gründung eines Unternehmens zur THC-Produktion nach dem neuen Verfahren. Kayser rechnet damit, dass dieses THC als Arzneistoff frühestens 2016 auf den Markt kommen kann.
      Der Typ will mit seiner Idee nun fett Kohle machen; da THC neben Nikotin und Alkohol die am meisten konsumierte Droge ist dürfte er viele Abnehmer haben :D
      Leider weiss ich im Moment noch nicht wie er dieses Verfahren etabliert hat und wie er diese genmanipulierten Bakterien erstellt hat, aber ich werde mich unbedingt mal darüber informieren.
      Die Vermutung das sie nun die Bakterien mit Olivetol füttern um die THC Synthese zu starten und welche THC Gene sie aus C.sative isoliert haben muss ich mich mal erkundigen.
      Wenn einer von euch dazu Informationen oder Wissen hat bitte unbedingt mir mitteilen!
      Auf jeden Fall der Zukunftweg für die THC-Synthese in der Wirtschaft.

      Gruß

      so sehen diese genmanipulierten Bakterien aus :





      edit:
      @dvrvm und Minhstar:
      ich habe da noch ein paar Fragen dazu, muss mich erstmal aber vorher einlesen zu dem was ihr gepostet habt, ich bin da nicht so bewandert.